Hacker Newsnew | past | comments | ask | show | jobs | submitlogin
Launch HN: RonanRX (YC S26) – Personalized Peptides and GLP-1s
118 points by lloydarmbrust 3 days ago | hide | past | favorite | 82 comments
Hi HN,

I’m Lloyd, one of two founders of RonanRx (https://ronanrx.com/). We are building a vertically integrated pharmaceutical company with software for prescribing, telehealth, compounding, manufacturing, and delivery. We are starting with GLP-1s and peptides.

The path to RonanRx is fairly unconventional. During the pandemic, I built one of the largest mask manufacturing factories in the US. We could make a million masks in a day. We converted raw polypropylene pellets into finished pallets of masks.

I had a background in software from my YC W10 company, so we took a software approach to building our factory. We used machine learning and computer vision to optimize production. We also vertically integrated almost everything. It worked. We built an efficient manufacturing operation and grew the business to 50 million dollars in revenue. Then people actually stopped caring about masks. Fair enough.

Around the same time, I decided to try and lose the weight I had gained while building the factory. I ate nothing but chicken for six months. While this diet got some results, I plateaued. My doctor suggested tirzepatide, a GLP-1 medication.

For me, losing weight was only the beginning. "Food noise" was gone. I showed less interest in other compulsive behavior. I stopped scrolling Instagram and quit biting my nails. But that was just the beginning. I was born with a congenital heart defect called aortic stenosis. My whole life doctors told me I'd need open heart surgery in my 40s (I am 45 now). After just 18 months using tirzepatide, my cardiologist’s began to think (and still thinks) my surgery could be pushed back until I am 70 or 80.

This was all happening when I was deciding what to work on next. I wanted to keep working on manufacturing. I didn't want to build another product that could be replicated by a frontier model. Pharmaceutical manufacturing was the best combination of digital, physical, biological, and regulatory infrastructure I could find. The thing that bothered me was how disconnected all of the pieces were: telehealth, EHR, prescriptions, dispensing software, production, shipping. No one company has it all.

GLP-1s come in a handful of predefined doses, but patients obviously aren't standardized: they respond differently, lose weight at different rates, experience different side effects, and may need very different doses. Compounding pharmacies can fill customized prescriptions, but they are not built like software companies. Workflows are manual, fragmented, and disconnected from the patient’s data. It's our goal to connect those pieces with RonanRx.

Patients either come to us directly or are referred by a physician. Once a patient is in our system, we collect medical records, current meds, labs, and data from wearables. Our software follows the prescription through drug formulation, compounding, quality testing, and drug dispensing and distribution.

The most interesting feature is the feedback loop. As the patient is undergoing treatment, their response becomes data that can be used by their doctor to modify the treatment. We keep the doctor in the feedback loop.

We make money by selling drugs we manufacture. Because people can buy directly from us, their price is usually 3x-10x more affordable. We can do this because we start at the molecule and own the entire stack from manufacturing through prescribing, dispensing, and delivery, instead of paying a chain of middlemen at every step.

We are beginning with GLP-1s and peptides since this was where I personally experienced the issue; however, we are more interested in the potential of patient-specific pharmaceutical manufacturing.

We would love your feedback, especially if you have built pharmacy, manufacturing, clinical infrastructure, EHRs, or any other regulated software. There are a lot of assumptions in this model that should be tested.

 help



You know the answer was obvious and I didn’t think to submit this to ycombinator since the idea is basically you’re front running a compounding pharmacies. This is combining a compounding pharmacy and an MSO.

At the same time, nothing is stopping you from hiring a fractional medical director and doctors alongside NP. I ran the numbers and 50k is is all you need to get a service agreement with a compounding pharmacy, back office tasks, incorporation, social media marketing policy to essentially drop ship your product as you use off the shelf products for charting and then begin expanding state coverage.

The July Medicare glp1 coverage also makes this most opportune.

Biggest barrier I thought was / is the credit card processing. You need to carry a certification for that.

HIPAA not an issue, BAA with most orgs that offer a saas products.

So damn. The glue isn’t really hard. Really didn’t think this would qualify as an ycombinator mvp. But here I am used To pitch decks promising exponential growth of subscription for cloud services.

As for personalized peptides in general, are you going to be marketing non FDA approved ones?

Or just stick with what’s already popular, generic wegovy, zepbound, etc. the market seems highly thin as a new MSO appears everyday using smartiq alongside med spas that offer more questionable inpatient services.

While manufacturing controls supply chain / logistics, the external pressure from every compounding pharmacist scaling into peptides now makes me wonder the longevity abo it this. You can literally pop on subreddits and see the flavor of the month telemedicine practice offer teaser rates of $99 for 60mg/month tirezepatide.

Oh and not forgetting the elephant in the room, gray market and china manufacturing which allows anyone with a telegram account to directly order whatever chemical name they read with no doctor oversight. It’s what, sub $1/mg now from the major vendors for tirezepatide?


You seem to know a lot about this, and I was nodding along with a lot of your points as I was reading.

I was Stripe's first customer in 2010, so we solved the credit card processing issue :) it turns out that being in YC is good for more than just money.

You are right about HIPAA, everyone thinks this is much harder than it actually is, but GCP, OpenAI, Linq, everyone has given us a BAA.

We're definitely not trying to go after the market of people that are comfortable buying from Chinese suppliers and risking their health. When I built my mask factory, our masks were absolutely more expensive than Chinese masks, but what people were buying was a guarantee that it would meet certain filtration requirements. Some people are willing to pay for safety, but it's not important to everyone.

The only thing I really disagree with with you on is that this isn't a YC-scale company.

We are growing 56% compounded week -over-week, and I have every expectation we'll do $10 million this year, $100 million next.

We are making something that people are already buying and getting it to them in a safer, more cost-effective way.


> We're definitely not trying to go after the market of people that are comfortable buying from Chinese suppliers and risking their health

Just being able to buy from a truly trusted vendor and not pay big pharma markup and I'm there. "Personalized" sounds cool, but all of that is fluff around affordable and trustable meds.


Don’t newly produced meds require new FDA clearance/approval, with clinical testing and all the like? I mean how else can you prove that your new drug production is effective and causes no new harms

2026 baby. Fill that bag up

Loopholes.

> You seem to know a lot about this, and I was nodding along with a lot of your points as I was reading.

Hire rootsudo? Email in the profile.


> I was Stripe's first customer in 2010

Would love to hear more about this, sounds like a fun time.

Are you planning to move from peptides to generics in the future? Also, considering you are looking at full vertical integration, is blood testing going to be a part of the pipeline in the future or will you partner with service providers? (I assume the latter until you grow enough to expand into that?)

While peptides are currently the hot market, I definitely can see the feedback loop being a great growth driver. Having a "hands-off" medication management with doses changing based on periodical labs result would be amazing - I am on a generic med (T4) for an autoimmune, and the process is annoying:

- Get labs done

- Schedule an endocrinologist, wait

- Reach out to my GP, have them bump my medications

- Wait for them to answer/arrange a checkup

- Wait for it to clear with the pharmacy

- Repeat

If this could be condensed in a loop that is basically get labs done -> pick up prescription, it would both reduce waiting time and reduce pressure on the med system, plus could be a huge data source on drug interactions.

Oh, and one last thing - considering the peptide market is currently full of grey/black market companies, drop-shippers and affiliate resellers, how do you plan to market it?

Especially judging by the site design, if I saw this link elsewhere I'd think it was AI dropshipping slop - no offense - mostly due to classic Claude design and the AI generated bottle/video.

Besides that, congratulations on the launch - love the vision and the future it can bring, hope you become at least a decacorn!


This is typical trend driven investment now, but late stage, influencers driver the market and then a lot of VCs seem to follow suit.

Are VCs still in the "smart money" cohort if they are following?

Reminds me of that Portlandia sketch "put a bird on it". Is it tech? Put AI on it. Is it health-adjacent? Put supplements / gray market / ethically-questionable-legislation-side-stepping on it.

Also makes me wonder, if AI is going to eat the world, why YC doesn't have a vibehouse spitting out thousands of these startups a month.


I think most people on gray market GLPs will vary their dose, take tolerance breaks, etc to meet their personal weight loss goals, this stuff isn't that complicated. Where I think where the real technology opportunity is, is having a personalized endocrinologist for TRT/HRT. Bodybuilders have incredibly sophisticated trackers with hormone/ester PK models and the ability to adjust and tune your personal model based on bloodwork results. Most men's clinic, online or in person, are nowhere near as advanced. Prescribing for most of these guys is binary, or adjusting your dose is something that's done in response to some sort of a problem like hematocrit or gyno, rather than trying to keep levels in-line with whatever health goal you have. I don't think most guys really need the full TRT dose of 140 mg/week to feel energetic again, but depending on your fitness goals you can go well beyond that safely as long as you are paying close attention. There have been a couple of "high tech HRT" apps but I don't think they are really all that sophisticated, maybe daily dosing or includes a tasso device or whatever, but nothing afaik with multi-hormone PK modeling and testing feedback, so it could be right up your alley.

The dosing starts out surprisingly simple. The magic is in the feedback loop: asking the patient how they're feeling, if they're getting the effects they want, and then having their doctor review and approve a new dose.

Point taken that RUO people are just yoloing this, I was one of them. Now, I can tell you that having a doctor in the loop with my health is very helpful.


I guess I'm trying to figure out what the secret sauce is that makes this a YC company, there are at least dozens, probably hundreds of telehealth GLP prescribers, manufacturing it yourself doesn't really seem like a value-add, all of them will compound with B12 for the reasons you mention elsewhere, it's hard to believe that "tell your doctor you're having side effects and they will adjust your dose" is a YC-worthy innovation. What am I missing?

Me too.

I get owning the supply chain and the compounding part.

There is big deal about 503a and 503b compounding pharmacies as well.

That's why the website copy is overdone with "for you" to qualify as and the example on the bottom shows Semaglutide and Cyanocobalamin (Vitamin b12) because that is the current FDA loophole.

They can not just offer the main compounded chemical/medicine but must combine it (alongside blood tests, supposedly but every other MSO skirts this by suggesting higher BMI during intake or a selfie.)

Any 503b compounding pharmacy selling compounded, non-additive Semagluitide is breaking the law.

A 503a is the loophole because the prescriber, "determines" and documents that the product change is neccessary/significant difference for said patient.

The current risk (or perhaps pro depending on how you want to look at it) in this political enviornment is positioning the company in a place to run foul of the FDA. Florida based compounding pharmacies are divesting from GLP-1's (e.g. BPI https://bpi-labs.net/ ) due to legal threat.

But then co-founder is ex-lily.


I respect the regulatory arbitrage, but for example Uber and Airbnb both arguably had pretty revolutionary tech layers on top of that. Trying to figure out what the equivalent here is.

Well, there are two big equivalents here: One, Uber successfully lobbied cities (NYC DeBlasio comes to mind, but there was one in London) - getting to a scale before meaningful enforcement action (which sometimes means investors maintaining their trust in the team, and the team sticking through the lawsuits) usually means you now have a customer base that is of voting age, and can substantially impact politics.

Two, Chevron deference is over. This is linked somewhat to the first - the overreach of federal agencies is now judicially balanced against the economic impact, not merely presumed authorized by Congress. Under this SCOTUS it is relatively uncertain which way FDA's authority will be curtailed - people will try, the fact that FDA wants to regulate the sale of non-invasive diagnostic equipment and mobile apps.. does warrant review and political discussion.


I'd wager the technical advantage is on the backend not the consumer facing. You'd be surprised how unsophisticated an unoptimized a lot of industries are.

On the manufacturing side of the world, "did this thing show up when I expected" is a remarkably difficult yet valuable question.


Previous YC founder so they’re already connected and vetted. Since then they’ve proven another 0-1 success with masks and manufacturing. Now they’re onto something very obviously hitting tailwinds.

The investment is peanuts to the fund. You’re missing the full-story deck and if they’ve shown traction it seems like a no brainer.

(btw for Lloyd the founder, Jason hired me right here from HN for ownlocal. It was my first professional software job. You guys made my career. Thank you)


So cool! Hundreds of careers and even families came from OwnLocal!

This 100% aligns with my experience. Peptides are easy and you can mix different GLP1s to get the desired effect of appetite suppression, food noise and metabolic boost via Tirz, Reta and Elora (don't use Cagri btw), but things start to get hairy with TRT/HRT. You really have to do blood work and getting it wrong has serious consequences.

what's wrong with cagri? I've heard it makes you tired, but nothing else bad about it really

Yes if you have no plans in life its perfect, just stay in bed all day.

Hey, I love the idea and the fully integrated approach! The feedback loop sounds great, and overall far better than the pretty generic companies I've dealt with for GLP before.

I've led building an EHR totally from scratch at one company and currently advising another as they build their EHR, both totally integrated approaches in industries where you usually have lots of disconnected care (adolescent serious mental illness and ABA/autism care). The state-by-state regulatory challenges are very real! If you want to chat, my email is in my profile!


I will reach out. Thank you!

Off by one letter compared to "Roman", which is a GLP prescriber farm, but you already knew this :). Hoping for a lawsuit to boost your fame?

https://en.wikipedia.org/wiki/Ro_(company)


The truth is a lot less exciting. We got into YC and registered the company name that night, and the domain name was available. The Ro connection was pointed out later. If we are forced to rebrand, we will be more thoughtful.

You probably not want this to show up in discovery documents when you do get sued. Pretend you didn't know about it.

lmao this comment is going to be pulled up by the plaintiff's lawyers and used to show willful infringement. someone's going to be paying treble + plaintiff's legal fees

seriously though you should probably consult a lawyer about whether to change the name, especially given that you've posed this comment in public


Looks like they don't use the Roman name anywhere, it's just Ro. If they changed in 2018 it should 100% count as abandoned trademark.

I guess I don’t look at company Wikipedia pages very often but this one seems particularly “written by corporate”.

In general yes, but what about this sentence:

> Reitano's personal experience with a heart condition, and his desire to recreate his father, a doctor, out of software as a hologram, inspired him to co-found the company.


This is a fantastic idea and could do a lot of real good. Any plans to get your hands on a distribution agreement for small molecule or peptide oral formulations?

I write a GLP1 newsletter and would love to learn more about what you’re building and how you see the landscape.

Reta looks like it will make it out by early next year but I personally think they’ll squeeze in to end of this year — there will likely never be a undersupply of GLP1s again and I wonder if the customization loopholes will hold (Lilly will certainly fight Reta compounders harder than they have others), interested to hear your thoughts and chat.


Fascinating. I work in this space sort of, there's still a ton I don't understand. What is the legal space like? Are you at risk of being shut down on a dime if the FDA decides Lilly can meet demand? Are you able to compound small molecules legally like orfoglipron? Are you only going after tirzepatide, or are mono agonists too available to justify? Are you ready for the retatrutide gold rush when that gets approved?

My experience with semaglutide has been incredible. I went on it to help lose weight while waiting 6 months to get an appliance for newly diagnosed sleep apnea. My primary care didn't have appetite to prescribe it so I went through a telehealth. The telehealth at least gets you a prescription but it's a really impersonal funnel. Then you get locked into a really rigid process. The 1.5 mg oral was amazing. But then I hit the plateau. The obvious things to do was up the dose. I did that - the next dose was 4 mg and after a couple weeks had total gastroparesis and vomiting for 1-2 weeks. During this time I couldn't take the drugs, had to drop the dose to titrate back up, and gained some weight back over the next month or so. I was able to up the dose again but you can't cut the pills due to the coating so I instead alternated 1.5 mg and 4 mg pills for a couple weeks. I had to do this by not taking the 1.5 mg pills for a few weeks to build up enough of a reserve. The company I was using was totally inflexible with regard to helping me gradually ramp the dose up. The alternating eventually got me to 4 mg and I was steady on that for a while but ultimately had a couple incidents of puking. I really need something like a 3mg pill. I tried skipping a day every few because the long half life should in theory make that a reasonable way to lower the daily average dose, but then the food noise comes right back. I really need like a 3 mg pill but I cannot get one. I decided that I was done with it and went to cancel but found out that if I cancel early I need to pay $450 cancellation fee. :)

Despite having a PhD and working in obesity drug r&d I have found this one of the most complicated, stupidly inflexible, frustrating spaces I've ever seen. If I'm getting my ass kicked like this, I can only imagine what everyone else is experiencing.

The frustrating thing is I really want to be on this drug. I have latent/sub clinical HS which results in chronic low grade armpit pain - I have not had that on glp1s, my sleep apnea has improved, I've lost weight, my anxiety and ADHD have improved. But I just can't get the right dose.


Looks interesting. What's your plan on the legal front? Bet the company on the compounding lawsuits breaking in your favor, or do you have a backup plan?

BTW: when you say you manufacture the drugs, I assume that means you're buying from an API supplier, but do you actually mean you're synthesizing it yourself?


We are co-manufacturing the API, and then we are bringing it in-house in the next 9 months.

The legal cutout that we have is on the personalization front, which is very well protected. The trick is that most compounders are not actually personalizing, and we are. Our feedback loop allows us to do real personalization on a week-by-week basis.


I think as long as you dont copy the exact 39 amino acid structure of Retatrutide, and dont use the word "Retatrutide" to describe it, you'll be outside the lawsuit targets of Eli Lilly. You'd want to improve the structure in some way, possibly by reducing the GI effects, as an example:

retatrutide sequence: YAQGTFTSDYSILLDKKAQAAFIEYLLEGGPSSGAPPPS

modified sequence to reduce GI symptoms: YAQGTFTSDYSILLDKKAHAAFIEYLLEGGPSSGAPPPS

The difference is in spot 18, where it swaps the alanine with a histidine, which may reduce GI effects/nausea.

reference: https://doi.org/10.7554/elife.68719

Another improvement might be to add amylin/calcitonin receptor agonist to the sequence (similar to cagrilintide). (reference: https://www.nejm.org/doi/full/10.1056/NEJMoa2502081)


My personal experience with GLP-1s was starting at 5 units, then progressing to 10, 15 and max it with 20 units. Where exactly do you see benefits of a personalized treatment: in the gaps between the existing doses, in ability of having even higher doses, or in dynamically changing the dose every month?

Signed up, made an appointment, the time was wrong; need a way to reschedule. Support hasn't responded either from an early morning message. Likely you're busy, not a great first time use so far, but hopefully it improves.

Check them support messages, especially day 1 / week 1! =)


I'm a big fan of, and customer of AgelessRx - https://agelessrx.com

Good luck with your venture!


This is a really beautiful site. Thank you for sharing it.

I think the only thing that separates us is that we manufacture the drugs and probably own more of the supply chain than they do. But they're doing a much better job on the front end.


You're welcome.

Yeah, they are pretty polished. But I've been with them for a few years and in the beginning their site was very much not polished, however, their products, service, and focus were a beacon.


Okay I'd love to hear your sales pitch as a theoretical customer. Imagine I'm getting tirzeptide grey-market as a peptide through one of the sites out there for ~$85 a month @ 2.5mg/wk. Suppose I've mentioned it to my doctor who was surprised but didn't raise any red flags, and I'm adjusting my dose to meet my own needs.

What's the best argument for me to switch? I also don't see any pricing on your website so I hypothetically wouldn't even consider signing up without knowing pricing in advance. It's also entirely acceptable that maybe this hypothetical version of me isn't the target market.


Congrats on the launch. I had a vague idea about personalized medication, did not know it was the VC style scaling of 10m$->100m$ ARR business!

There are some messages here complaining about the website being claude(ish). I know HN has people that care about this. They should. Mostly they would be right. But i don't see it being relevant here. Complaining about this business's website is like fluid-mechanics engineers at NASA complaining about friction dynamics on office floor-carpeting instead of rockets.


We've definitely been focused on the more important parts first. I just need one flight from SFO to Austin to fix this website issue.

So your other founder is a doctor or a pharmacist right? Right?

Does this move the needle on affordability or insurance coverage for these drugs? $500/month for Tirzepatide is not something most people can afford.

edit: I see significantly lower pricing than e.g. LilyDirect. Does this work with HSA/FSA reimbursement, too?


The idea sounds great but it defaults on mobile to a full screen chat window basically. Super annoying. I would change that asap.

Really loved this approach. I want to ask what peps are you starting off with and how would this approach work competing with grey market ROU peps?

Also is there a way to contact you? I have some personal questions as a fellow pep user.


>so we took a software approach to building our factory.

I wouldnt step inside the building, its probably going to fall down every other sprint for the first few years.


I see what you did there, and I approve this joke.

Familiar name. Same guy who made the masks during COVID-19?

Second paragraph, “During the pandemic, I built one of the largest mask manufacturing factories in the US”

Haha, entirely my fault but the default font greys out the text so I always just click through to the site instead of reading the Launch HN / Show HN copy. Regardless, I will take my well-deserved brickbats.

Second paragraph:

  The path to RonanRx is fairly unconventional. During the pandemic, I built one of the largest mask manufacturing factories in the US. We could make a million masks in a day. We converted raw polypropylene pellets into finished pallets of masks.

Yeah. Armbrust Inc. It's me.

I'm curious, when you say you're creating vertical integration—are you tackling GMP manufacturing and fill finish as well?

Yes. I've done it before with medical devices. Pharma is surprisingly similar, but there's more testing.

really interesting. a lot turns on whether the personalization is actually substantive. if it’s tirz at scale w/personalized layer on top, 503a seems shaky. also curious how the patent side plays out, since 503a doesn’t solve that. very interested to see where this lands.

surely you'll get sued by the GLP-1 patent owners like HIMs did if you sell your own product? & can physicians recommend non-FDA approved manufactured drugs?

fixed glp-1 doses for non-standard patients is the gap. owning molecule to delivery just funds the feedback loop with the doctor still in it.

You manufacture the drugs yourself? That's impressive, and it feels like an interesting company.

Your website sucks though. We can tell you vibe coded it quickly and didn't put much thought into it.


Yes, we incorporated the business 10 weeks ago, and we've been focusing everything on the infrastructure of the actual product people are getting.

These messages are very helpful, though, to help motivate me to get our team to fix this, so I do appreciate it.


I think you should focus on the fundamentals, this kind of feedback is inevitable and I'm sure you anticipated it anyways.

Building a startup, everything is important, but you do have to stack rank. This is getting to the point where it's probably the most important thing. And it won't take that long to fix.

Please have a human rewrite your site copy. Literally every second sentence is a Claudish rhetorical contrastive. Maybe shallow/unfair, but especially when dealing with something medical I’d love to know that it’s not slop all the way down.

It’s funny, it’s obviously understandable why someone would vibe code a placeholder website, we’ve all probably done it. But I’m realizing a basic unstyled html thing with minimal copy is probably a better signal at this point for startups, it makes it clear you are still working on it rather than giving up the impression you might think your vibeslop is the finished product.

Fair criticism. It is AI slop all the way down. The only thing we focused on was the clinical aspects of the onboarding and the technical ability to be able to legally write a prescription and make and ship drugs, which was very complicated. We were able to accomplish this in less than 10 weeks. But I have not had time to go through all the marketing, and I apologize.

Ironically even this comment feels AI generated :/

My wife tells me all the time I sound like AI. I blame my childhood.

I blame your fine-tuning.

She’s been doing supervised fine-tuning since 2017.

>Around the same time, I decided to try and lose the weight I had gained while building the factory. I ate nothing but chicken for six months. While this diet got some results, I plateaued. My doctor suggested tirzepatide, a GLP-1 medication.

This is a poor diet, where are the carbs and fats? So you dieted badly, and your conclusion from this is to use GLP drugs?

Did you ever try a moderate deficit over long periods of time?

We run a public benefit app called macrocodex which is completely free, no paywall, no subscription, and it produces guaranteed weight loss or gain within 2 to 4 weeks.

Most people never see a weight loss plateau; you can read the reviews if you are skeptical of the claims.

Problem with GLP-1 agonists is that it's very easy for a person to crash their diet.

In GLP-1s drug use, the primary cause of weight loss by reduction in appetite/desire to eat -> you eat less -> calorie deficit -> weight loss

Deficit doesn't really go away! So it's funny when people say "calorie deficit doesn't work but GLP drugs do", I wonder if they believe GLP-1 have secret fat melting property or something.


Have you tried a GLP-1?

GLPs have lower effectiveness for the vast majority of overweight and fat people than macrocodex. You can look up GLP non-responder data; furthermore, many people use GLP-1 in a knee-jerk fashion, crashing their nutrition, which may result in loss of lean mass, bile issues, and gallbladder stone risks.

And i am not the only one who is saying this, look at this: https://www.reddit.com/r/tirzepatidecompound/comments/1omfgx...

If GLP-1 are effective, then why do people who are using GLP-1 for some time need this guide (macrocodex's guide)?

Macrocodex has 16,000+ users and it's free, there are no ads so there is nothing to sell there.

Here you can see our GLP dosing protocol: https://macrocodex.app/knowledge/rethink/glp-1-agonists-dosi...

Our group has 2000+ people and macrocodex users beat GLP1 drug users by long shot.

You can find even more evidence by searching for "macrocodex" reviews. Very simple and doesn't cost anything


I'm just asking if you've ever used one.

I don't want to assume, but if you've used one, you would understand the benefits are far greater than weight loss.


What exactly are these benefits beyond weight loss?

[flagged]


Please don't harangue people about exercise and diet on HN. Everyone has heard it countless times here and elsewhere. Obviously, many people find that approach doesn't (easily) work. Yes, it's well known GLP-1s can have negative effects. Many people still find them beneficial anyway, and many people take measures to address the negative effects. None of this is simple or easy, so please stop making it out like it should be a simple or easy decision for people to just do as you suggest.

In HN guidelines terms, these sections are relevant:

Be kind. Don't be snarky. Converse curiously; don't cross-examine. Edit out swipes.

Comments should get more thoughtful and substantive, not less, as a topic gets more divisive.

Eschew flamebait. Avoid generic tangents. Omit internet tropes.

Please don't post shallow dismissals, especially of other people's work. A good critical comment teaches us something.

https://news.ycombinator.com/newsguidelines.html


Pushing drugs to people which can crash your appetite is much more dangerous than promoting exercise and diet to sedentary people.

Getting 20 kg overweight only requires a 100 kcal surplus over a period of 4 years.

That's not proof that diet and exercise are not working, and it doesn't prove you need GLP-1s to resist an extra 100 kcal a day. Two slices of bread have 130 kcal for comparison.


It’s this repetition of caloric balance dogma that’s most unhelpful and unwelcome here. If if was that simple, everyone would already have done it. Appetite and metabolism are not that simple and continuing to insist that they are serves only to alienate anyone who isn’t already committed to that worldview. Nobody disputes that there are risks that need to be understood and addressed.

> Appetite and metabolism are not that simple and continuing to insist that they are serves only to alienate anyone

Funny enough, you want to argue with people who have done some real work in this field and produced results in thousands of people? But you do not provide any refutation.

I think i know quite a lot about this already: https://macrocodex.app/knowledge/macrocodex/smart-calorie-bu...

We've written this algorithm; it factors all the math and current research. Let me know if you have any evidence to refute this, or if you have any paper or mechanism we do not already factor in.

Here's our claim: "Guaranteed results within 2-4 weeks of using macrocodex, people will see weight loss or weight gain depending on what they want."

And we do not even have a paywall, ads, or upsells in our proof-of-concept app, which implements this algorithm.

Other than this we've people already seeing benefit from our approach, just because you failed to apply deficit doesn't mean "calorie deficit" doesn't work or "calorie balance" is flawed, you simply fail at figuring out how much you actually burn

Also, we are challenge any organization to perform trial:

Macrocodex vs. GLP-1 drugs: on average overweight and obese individuals

Our data demonstrate Macrocodex will come out ahead of GLP-1 drugs.


Now that I've looked through your comment history, I see that you've been using HN for self-promotion, which is also against the guidelines.

If you have material consisting of novel research that the audience will find intellectually gratifying, you're welcome to share it as a standalone post.

It's not good community participation to hijack other people's launch posts with this kind of antagonistic commentary when you have a competing agenda.

Edit: removed initial mistaken accusation of failing to disclose competing product.


Did you read the very first reply I posted? I clearly disclosed "we run public benefit app".

OK, sorry for that; I've removed the accusation of failing to disclose your competing service.

It's still not great community participation, piggy-backing onto someone else's launch thread with these kinds of comments, and repeatedly insisting that weight loss via diet and exercise is easy (people have been saying it for decades and it clearly isn't, otherwise there would be no demand for GLP-1 drugs).

The case remains that your style of participation on HN is self-promotional. If you want to generate attention for your research and program/app, please earn the exposure by writing a deep-dive post that can engage the intellectual curiosity of the HN audience.




Guidelines | FAQ | Lists | API | Security | Legal | Apply to YC | Contact

Search: